PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678462123
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 558aa    MW: 62689.2 Da    PI: 4.8057
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678462123genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS427.21.3e-1301895582374
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                ++lL+ecA  v+ g++e+a+ +++ l+e++s +gdp +R+aay++eALaar+a+s+ +lykal++++++   s ++l+a+++++ev+P+++f+++taN+a
  678462123 189 RDLLFECAALVQYGKFERATDMVNILRERVSIQGDPSERIAAYMVEALAARMASSGRGLYKALKCKQQP---SLDRLSAMQVLFEVCPCFRFGFMTANSA 285
                579*****************************************************************9...9*************************** PP

       GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpg 199
                Ilea + e+++Hi+Dfdi+qG Q+ +Ll++La++ ++  ++++Tgv++pes+      l+ +g+rL+++Ae+l+++fef++ +a +++ +++++Lr++p+
  678462123 286 ILEACKFEKKIHIVDFDINQGSQYYTLLKTLAEKLGPRVKVKLTGVDDPESVqrPVGGLRIIGQRLEQLAENLQLSFEFHA-LAAETALISPSMLRCQPD 384
                **************************************************99888899***********************.59999************* PP

       GRAS 200 EalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvva 299
                Eal+Vn+++qlh+++desvs+ + rd++L++vksl+Pk+v++veq++++n+++Fl rf+ea +yysa+f+sl+a lpr+s++r++vE+++l+rei nv+a
  678462123 385 EALVVNFAFQLHHMPDESVSTVNMRDQLLRMVKSLKPKLVTLVEQNLNTNTSPFLPRFAEAYSYYSAVFESLDAALPRDSQDRMNVEKQCLAREIINVIA 484
                **************************************************************************************************** PP

       GRAS 300 cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                ceg++r+er e ++kW++r+++aGF + p+ +++ ++++ l+++++ + y++e++ g+l +gW+d+ L++ S Wr
  678462123 485 CEGEDRIERYEVAGKWSARMSMAGFASCPIASRVKTEIRELIQQYSTR-YKMEDQMGALHFGWEDKLLIFSSTWR 558
                **********************************************77.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.487162539IPR005202Transcription factor GRAS
PfamPF035144.5E-128189558IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MPLVRCAAVF GNHDTYSMKS SRKTSDLNPE NHEGYISDPY DGVGYDHTSF IDSPSDEILD  60
VMGLDVLENS SHETYLKNSA CSLLVSKHNG FRFDGEKDSM NIQNPIEYDG NKLTLKIQEL  120
EKALLDDNAA EDDCIIDHYN PMDIDSEWAV AISLPLVDGS PKQTSSSESE ITSTSSPQEI  180
PCTTPSSPRD LLFECAALVQ YGKFERATDM VNILRERVSI QGDPSERIAA YMVEALAARM  240
ASSGRGLYKA LKCKQQPSLD RLSAMQVLFE VCPCFRFGFM TANSAILEAC KFEKKIHIVD  300
FDINQGSQYY TLLKTLAEKL GPRVKVKLTG VDDPESVQRP VGGLRIIGQR LEQLAENLQL  360
SFEFHALAAE TALISPSMLR CQPDEALVVN FAFQLHHMPD ESVSTVNMRD QLLRMVKSLK  420
PKLVTLVEQN LNTNTSPFLP RFAEAYSYYS AVFESLDAAL PRDSQDRMNV EKQCLAREII  480
NVIACEGEDR IERYEVAGKW SARMSMAGFA SCPIASRVKT EIRELIQQYS TRYKMEDQMG  540
ALHFGWEDKL LIFSSTWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-6021455829375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101898.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101891.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101887.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101883.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A068UU850.0A0A068UU85_COFCA; Uncharacterized protein
STRINGPOPTR_0005s20890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1